VGLUT2 Rabbit monoclonal antibody

Size

POA

SKU:: A27586
Additional Names:: DNPI|VGLUT2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 64 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
Uniprot:: Q9P2U8
Synonyms:: differentiation-associated BNPI;differentiation-associated Na-dependent inorganic phosphate cotransporter;differentiation-associated Na(+)-dependent inorganic phosphate cotransporter;DNPI;solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6;solute carrier family 17 (vesicular glutamate transporter), member 6;Solute carrier family 17 member 6;vesicular glutamate transporter 2;VGLUT2
Extra Details:: Predicted to enable L-glutamate transmembrane transporter activity and neurotransmitter transmembrane transporter activity. Involved in neurotransmitter loading into synaptic vesicle. Predicted to be located in synaptic vesicle. Predicted to be active in excitatory synapse. Predicted to be integral component of synaptic vesicle membrane.