[KO Validated] Lactate Dehydrogenase B/LDH-B Rabbit monoclonal antibody

Size

POA

SKU:: A27584
Additional Names:: HEL-S-281|LDH-B|LDH-H|LDHBD|TRG-5
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIV
Uniprot:: P07195
Synonyms:: epididymis secretory protein Li 281;HEL-S-281;L-lactate dehydrogenase B chain;lactate dehydrogenase H chain;LDH heart subunit;LDH-B;LDH-H;LDHBD;renal carcinoma antigen NY-REN-46;testicular secretory protein Li 25;TRG-5
Extra Details:: This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13.

Shipping Conditions:: Blue Ice