CFHR1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2743
Additional Names:: CFHL|CFHL1|CFHL1P|CFHR1|CFHR1P|FHL-1|FHR-1|FHR1|H36|H36-1|H36-2|HFL1|HFL2
Application:: ELISA, WB
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Uniprot:: Q03591
Synonyms:: CFHL;CFHL1;CFHL1P;CFHR1P;complement factor H-related 1 pseudogene;complement factor H-related protein 1;FHR-1;FHR1;H factor (complement)-like 1;H factor (complement)-like 2;h factor-like protein 1;H-factor-like 1;H36;H36-1;H36-2;HFL1;HFL2
Extra Details:: This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome.