POU1F1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A27420
Additional Names:: CPHD1|GHF-1|Pit-1|PIT1|POU1F1a
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 33kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQ
Uniprot:: P28069
Synonyms:: CPHD1;GHF-1;growth hormone factor 1;Pit-1;PIT1;pituitary transcript factor 1;pituitary-specific positive transcription factor 1;POU domain, class 1, transcription factor 1;POU1F1a
Extra Details:: This gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combined pituitary hormone deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.