A27378
Biotin Rabbit anti-Human CD7 monoclonal antibody
Size
POA
- SKU:
- A27378
- Additional Names:
- GP40|LEU-9|Tp40|TP41
- Application:
- Flow Cytometry
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
- Uniprot:
- P09564
- Synonyms:
- CD7 antigen (p41);GP40;LEU-9;p41 protein;T-cell antigen CD7;T-cell leukemia antigen;T-cell surface antigen Leu-9;Tp40;TP41
- Extra Details:
- This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
- Shipping Conditions:
- Blue Ice