A27359
Biotin Rabbit anti-Mouse CD28 monoclonal antibody
Size
POA
- SKU:
- A27359
- Additional Names:
- Cd28
- Application:
- Flow Cytometry
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
- Uniprot:
- P31041
- Synonyms:
- T-cell-specific surface glycoprotein CD28;Tp44
- Extra Details:
- Enables protein kinase binding activity. Acts upstream of or within several processes, including positive regulation of immune response; positive regulation of intracellular signal transduction; and regulation of lymphocyte activation. Located in external side of plasma membrane and immunological synapse. Human ortholog(s) of this gene implicated in multiple sclerosis and type 1 diabetes mellitus. Orthologous to human CD28 (CD28 molecule).
- Shipping Conditions:
- Blue Ice