PE Rabbit anti-Mouse CD23 monoclonal antibody

Size

POA

SKU:: A27347
Additional Names:: CD23|Fce2|Fcer2|Ly-42
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP
Uniprot:: P20693
Synonyms:: BLAST-2;C-type lectin domain family 4, member J;CD23;CD23 antigen;CD23A;CLEC4J;Fc epsilon receptor II;FC epsilon RII;Fc fragment of IgE, low affinity II, receptor for (CD23);fc-epsilon-RII;FCE2;Fcer2;IGEBF;immunoglobulin E-binding factor;immunoglobulin epsilon-chain;low affinity immunoglobulin epsilon Fc receptor;low-affinity IgE receptor;Ly-4;Ly-42;lymphocyte IgE receptor
Extra Details:: Predicted to enable carbohydrate binding activity. Acts upstream of or within positive regulation of humoral immune response mediated by circulating immunoglobulin. Located in external side of plasma membrane. Orthologous to human FCER2 (Fc fragment of IgE receptor II).