APC Rabbit anti-Mouse CD11a monoclonal antibody

Size

POA

SKU:: A27338
Additional Names:: (p180)|Cd11a|LFA-1|LFA-1A|Ly-15|Ly-21
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KGKVDLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDLQRRIYAIEGTNRQDL
Uniprot:: P24063
Synonyms:: (p180);alpha L integrin;antigen CD11A (p180), lymphocyte function-associated antigen 1, alpha polypeptide;Cd11;CD11 antigen-like family member A;CD11A;integrin alpha-L;integrin gene promoter;integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide);leukocyte adhesion glycoprotein LFA-1 alpha chain;leukocyte function-associated molecule 1 alpha chain;LFA;LFA-1;LFA-1 alpha;LFA-1A;LFA1A;Ly-1;Ly-15;Ly-2;Ly-21;lymphocyte antigen 15;lymphocyte function associated antigen 1, alpha polypeptide;lymphocyte function-associated antigen 1, alpha polypeptide
Extra Details:: Predicted to enable ICAM-3 receptor activity and cell adhesion molecule binding activity. Involved in cell-cell adhesion. Acts upstream of or within several processes, including activated T cell proliferation; positive regulation of T cell proliferation; and positive regulation of calcium-mediated signaling. Located in cell-cell junction; external side of plasma membrane; and immunological synapse. Is expressed in heart; hemolymphoid system; and vault of skull. Orthologous to human ITGAL (integrin subunit alpha L).

Shipping Conditions:: Blue Ice