Nucleophosmin Rabbit monoclonal antibody

Size

POA

SKU:: A27297
Additional Names:: B23|NPM
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEED
Uniprot:: P06748
Synonyms:: B23;NPM;Nucleolar phosphoprotein B23;nucleolar protein NO38;nucleophosmin;nucleophosmin (nucleolar phosphoprotein B23, numatrin);nucleophosmin/nucleoplasmin family, member 1;Numatrin;testicular tissue protein Li 128
Extra Details:: The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified.