[KD Validated] ECHS1 Rabbit monoclonal antibody

Size

POA

SKU:: A27295
Additional Names:: ECHS1D|mECH|mECH1|SCEH
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 31kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
Uniprot:: P30084
Synonyms:: ECHS1D;enoyl Coenzyme A hydratase, short chain, 1, mitochondrial;Enoyl-CoA hydratase 1;enoyl-CoA hydratase, mitochondrial;enoyl-CoA hydratase, short chain, 1, mitochondrial;epididymis secretory sperm binding protein;SCEH;short chain enoyl-CoA hydratase;Short-chain enoyl-CoA hydratase
Extra Details:: The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.

Shipping Conditions:: Blue Ice