[KD Validated] ADAR1 Rabbit monoclonal antibody

Size

POA

SKU:: A27294
Additional Names:: ADAR1|AGS6|DRADA|DSH|DSRAD|G1P1|IFI-4|IFI4|K88DSRBP|P136
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPKFQYCVAVGAQTFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPV
Uniprot:: P55265
Synonyms:: 136 kDa double-stranded RNA-binding protein;ADAR1;adenosine deaminase acting on RNA 1-A;AGS6;double-stranded RNA-specific adenosine deaminase;DRADA;DSH;DSRAD;dsRNA adenosine deaminase;dsRNA adeonosine deaminase;G1P1;IFI-4;IFI4;interferon-induced protein 4;interferon-inducible protein 4;K88DSRBP;P136
Extra Details:: This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double-stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternative splicing results in multiple transcript variants.