[KD Validated] ECH1 Rabbit monoclonal antibody

Size

POA

SKU:: A27290
Additional Names:: HPXEL
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: APDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKT
Uniprot:: Q13011
Synonyms:: delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial;delta3,5-delta2,4-dienoyl-CoA isomerase;delta3,5-delta2,4-dienoyl-coenzyme A isomerase;dienoyl-CoA isomerase;enoyl Coenzyme A hydratase 1, peroxisomal;enoyl-CoA hydratase 1, peroxisomal;epididymis secretory sperm binding protein;HPXEL;peroxisomal enoyl-CoA hydratase 1
Extra Details:: This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.

Shipping Conditions:: Blue Ice