PE Rabbit anti-Mouse CD204 monoclonal antibody

Size

POA

SKU:: A27278
Additional Names:: MRS-A|MSR|MSR-A|Scara1|Scvr|SR-A|SR-AI|SR-AII
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GSTPLKTVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Uniprot:: P30204
Synonyms:: CD204;macrophage acetylated LDL receptor I and II;macrophage scavenger receptor type III;macrophage scavenger receptor types I and II;MR;MRS-A;MS;MSR;MSR-A;phSR1;phSR2;S;Sc;SCARA1;scavenger receptor class A member 1;scavenger receptor type A;Scvr;SR-A;SR-AI;SR-AII;SR-AIII;SRA
Extra Details:: Enables amyloid-beta binding activity; cargo receptor activity; and low-density lipoprotein particle binding activity. Involved in several processes, including endocytosis; positive regulation of cholesterol storage; and positive regulation of macrophage derived foam cell differentiation. Acts upstream of or within establishment of localization in cell and lipoprotein transport. Located in plasma membrane. Is expressed in several structures, including alimentary system; early conceptus; limb; neural tube; and reproductive system. Human ortholog(s) of this gene implicated in Barrett's esophagus; arteriosclerosis; and prostate cancer. Orthologous to human MSR1 (macrophage scavenger receptor 1).

Shipping Conditions:: Blue Ice