PE Rabbit anti-Human CD336/NKp44 monoclonal antibody

Size

POA

SKU:: A27276
Additional Names:: CD336|dJ149M18.1|LY95|NK-p44|NKP44
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP
Uniprot:: O95944
Synonyms:: CD336;dJ149M18.1;LY95;lymphocyte antigen 95 (activating NK-receptor; NK-p44);Lymphocyte antigen 95 homolog;lymphocyte antigen 95 homolog (activating NK-receptor; NK-p44);natural cytotoxicity triggering receptor 2;natural killer cell p44-related protein;NK cell activating receptor (NKp44);NK cell-activating receptor;NK-p44;NKP44
Extra Details:: Predicted to enable signaling receptor activity. Predicted to be involved in cellular defense response and signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane. Predicted to be active in cell surface.