MECR Rabbit monoclonal antibody

Size

POA

SKU:: A27253
Additional Names:: CGI-63|DYTOABG|ETR1|FASN2B|NRBF1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Uniprot:: Q9BV79
Synonyms:: 2-enoyl thioester reductase;CGI-63;DYTOABG;enoyl-[acyl-carrier-protein] reductase, mitochondrial;ETR1;FASN2B;homolog of yeast 2-enoyl thioester reductase;mitochondrial 2-enoyl thioester reductase;NRBF1;nuclear receptor binding factor 1;Nuclear receptor-binding factor 1;trans-2-enoyl-CoA reductase, mitochondrial
Extra Details:: The protein encoded by this gene is an oxidoreductase that catalyzes the last step in mitochondrial fatty acid synthesis. Defects in this gene are a cause of childhood-onset dystonia and optic atrophy.