EGR1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2722
Additional Names:: AT225|EGR1|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 75kDa/100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVP
Uniprot:: P18146
Synonyms:: AT225;early growth response protein 1;EGR-1;G0S30;KROX-24;nerve growth factor-induced protein A;NGFI-A;TIS8;transcription factor ETR103;transcription factor Zif268;ZIF-268;zinc finger gene 225;zinc finger protein 225;zinc finger protein Krox-24;ZNF225
Extra Details:: The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene.