APC Rabbit anti-Mouse KLRG1/MAFA monoclonal antibody

Size

POA

SKU:: A27186
Additional Names:: 2F1-Ag|MAFA|MAFA-L
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Uniprot:: O88713
Synonyms:: 2F1;2F1-A;2F1-Ag;C-type lectin domain family 15 member A;CLEC15A;ITIM-containing receptor MAFA-L;killer cell lectin-like receptor subfamily G member 1;killer cell lectin-like receptor subfamily G, member 1;MAFA;MAFA-2F1;MAFA-L;MAFA-LIKE;MAFA-like receptor;mast cell function-associated antigen (ITIM-containing);mast cell function-associated antigen 2F1
Extra Details:: Predicted to enable carbohydrate binding activity. Predicted to act upstream of or within cell surface receptor signaling pathway. Predicted to be located in intracellular membrane-bounded organelle. Orthologous to human KLRG1 (killer cell lectin like receptor G1).