ABflo[R] 488 Rabbit anti-Mouse CD270/HVEM monoclonal antibody

Size

POA

SKU:: A27135
Additional Names:: Atar|HveA|Hvem|Tnfrs14|TR2
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV
Uniprot:: Q80WM9
Synonyms:: A;ATAR;CD270;CD40-like protein;herpes virus entry mediator A;herpesvirus entry mediator A;Hv;Hve;HVEA;HVEM;LIGHTR;Tnfrs14;TR2;tumor necrosis factor receptor superfamily member 14;tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator);tumor necrosis factor receptor-like 2;tumor necrosis factor receptor-like gene2
Extra Details:: Predicted to enable cytokine binding activity and ubiquitin protein ligase binding activity. Acts upstream of or within several processes, including defense response to bacterium; negative regulation of alpha-beta T cell proliferation; and positive regulation of macromolecule metabolic process. Located in external side of plasma membrane. Is expressed in liver lobe. Orthologous to human TNFRSF14 (TNF receptor superfamily member 14).