APC Rabbit anti-Mouse CD103 monoclonal antibody

Size

POA

SKU:: A27134
Additional Names:: A530055J10|alpha-E1|alpha-M290|aM290|CD103
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EDGTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFECNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTASAMQHVLDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIGVGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLLSKLQQHIVHMEGT
Uniprot:: Q60677
Synonyms:: A530055J10;alph;alpha-E1;alpha-M290;aM290;antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide;CD103;HML-1 antigen;human mucosal lymphocyte antigen 1, alpha polypeptide;HUMINAE;integrin alpha M290;integrin alpha-E;integrin alpha-IEL;integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide);mucosal lymphocyte 1 antigen
Extra Details:: Predicted to enable metal ion binding activity. Predicted to act upstream of or within cell adhesion and integrin-mediated signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; genitourinary system; lymph node; nasal septum; and nucleus pulposus. Orthologous to human ITGAE (integrin subunit alpha E).