A2697
CLEC4D Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2697
- Additional Names:
- CD368|CLEC-6|CLEC4D|CLEC6|CLECSF8|Dectin-3|MCL|MPCL
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 27 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
- Uniprot:
- Q8WXI8
- Synonyms:
- C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 8;C-type lectin domain family 4 member D;C-type lectin receptor;C-type lectin superfamily member 8;C-type lectin-like receptor 6;CD368;CLEC-6;CLEC6;CLECSF8;DC-associated C-type lectin 3;Dectin 3;Dectin-3;dendritic cell-associated C-type lectin 3;macrophage C-type lectin;MCL;MPCL
- Extra Details:
- This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
- Shipping Conditions:
- Blue Ice