CD74 Rabbit PolymAb[R]

Size

POA

SKU:: A26945PM
Additional Names:: CLIP|DHLAG|HLADG|Ia-GAMMA|II|p33
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 35-40 kDa
Species Reactivity:: Human, Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Uniprot:: P04233-2, P04441-2
Synonyms:: C;CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated);CD74 molecule, major histocompatibility complex, class II invariant chain;class II-associated invariant chain peptide;CLIP;DHLAG;dinucleotide microsatellite;gamma chain of class II antigens;H-2 class II histocompatibility antigen gamma chain;histocompatibility: class II antigens, gamma chain of;HLA class II histocompatibility antigen gamma chain;HLA-DR antigens-associated invariant chain;HLA-DR-gamma;HLADG;ia antigen-associated invariant chain;Ia-associated invariant chain;Ia-GAMMA;II;ii chain;invariant polypeptide of major histocompatibility complex, class II antigen-associated;MHC class II-associated invariant chain;MHC HLA-DR gamma chain;p33
Extra Details:: The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Shipping Conditions:: Blue Ice