PE Rabbit anti-Mouse CD265/RANK monoclonal antibody

Size

POA

SKU:: A26918
Additional Names:: Ly109|mRANK|ODFR|OFE|Rank|TRANCE-R
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLP
Uniprot:: O35305
Synonyms:: CD265;familial expansile osteolysis;FEO;LOH18CR1;loss of heterozygosity, 18, chromosomal region 1;Ly109;mRANK;ODFR;OFE;OPTB7;osteoclast differentiation factor receptor;OSTS;Paget disease of bone 2;PDB2;RANK;receptor activator of NF-kappaB;receptor activator of NF-KB;receptor activator of nuclear factor-kappa B;TRANCE receptor;TRANCE-R;TRANCER;tumor necrosis factor receptor superfamily member 11A;tumor necrosis factor receptor superfamily, member 11a, NFKB activator
Extra Details:: Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including circadian temperature homeostasis; positive regulation of fever generation by positive regulation of prostaglandin secretion; and tumor necrosis factor-mediated signaling pathway. Acts upstream of or within several processes, including hematopoietic or lymphoid organ development; mammary gland alveolus development; and positive regulation of bone resorption. Located in cell surface. Is expressed in bladder and lymphatic system. Human ortholog(s) of this gene implicated in Paget's disease of bone; autosomal recessive osteopetrosis 7; bone development disease; familial expansile osteolysis; and osteoporosis. Orthologous to human TNFRSF11A (TNF receptor superfamily member 11a).

Shipping Conditions:: Blue Ice