SLC23A2 Rabbit polyclonal antibody

Size

POA

SKU:: A26880
Additional Names:: NBTL1|SLC23A1|SVCT2|YSPL2
Application:: ELISA, WB
Molecular Weight:: 72kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NVLLTTAMFVGGCVAFILDNTIPGTPEERGIRKWKKGVGKGNKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFVGYTWKGLRKSDNSRSSDEDSQATG
Uniprot:: Q9UGH3
Synonyms:: Na(+)/L-ascorbic acid transporter 2;NBTL1;nucleobase transporter-like 1 protein;SLC23A1;Sodium-dependent vitamin C transporter 2;sodium-dependent vitamin C transporter-2;solute carrier family 23 (ascorbic acid transporter), member 2;solute carrier family 23 (nucleobase transporters), member 1;solute carrier family 23 (nucleobase transporters), member 2;solute carrier family 23 member 2;SVCT2;testicular secretory protein Li 48;yolk sac permease-like molecule 2;YSPL2
Extra Details:: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.