CCL25 Rabbit polyclonal antibody

Size

POA

SKU:: A2685
Additional Names:: CCL25|Ck beta-15|Ckb15|SCYA25|TECK|TECKvar
Application:: ELISA, WB
Molecular Weight:: 20KDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Uniprot:: O15444
Synonyms:: C-C motif chemokine 25;chemokine (C-C motif) ligand 25;chemokine TECK;Ck beta-15;Ckb15;SCYA25;small inducible cytokine subfamily A (Cys-Cys), member 25;small-inducible cytokine A25;TECK;TECKvar;thymus expressed chemokine;Thymus-expressed chemokine
Extra Details:: This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants.