![ABflo[R] 488 Rabbit anti-Mouse CD50/ICAM-3 monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26794/A26794_1.jpg)
![ABflo[R] 488 Rabbit anti-Mouse CD50/ICAM-3 monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26794/A26794_2.jpg)
![ABflo[R] 488 Rabbit anti-Mouse CD50/ICAM-3 monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26794/A26794_ARC69845-01-ABf488-01(Green)i_FC_01.jpg)
![ABflo[R] 488 Rabbit anti-Mouse CD50/ICAM-3 monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26794/A26794_ARC69845-01-ABf488-01(Green)i_FC_02.jpg)
A26794
ABflo[R] 488 Rabbit anti-Mouse CD50/ICAM-3 monoclonal antibody
Size
POA
- SKU:
- A26794
- Additional Names:
- CD50|ICAM-3|ICAM-5|Icam3|Tlcn|TLN
- Application:
- Flow Cytometry
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EPFWADLQPRVALVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELVPLPSWQPVGENFTLSCRVPGAGPRASLTLTLLRGGQELIRRSFVGEPPRARGAMLTARVLARREDHRVNFSCLAELDLRPHGLGLFANSSAPRQLRTFAMP
- Uniprot:
- Q60625
- Synonyms:
- CD50;Ica;ICAM-3;ICAM-5;Icam3;intercellular adhesion molecule 3;intercellular adhesion molecule 5;intercellular adhesion molecule 5, telencephalin;T;telencephalin;Tl;TLCN;TLN
- Extra Details:
- Predicted to enable integrin binding activity. Acts upstream of or within phagocytosis. Located in plasma membrane. Is expressed in brain. Orthologous to human ICAM5 (intercellular adhesion molecule 5).
- Shipping Conditions:
- Blue Ice