PE Rabbit anti-Mouse CD50/ICAM-3 monoclonal antibody

Size

POA

SKU:: A26793
Additional Names:: CD50|ICAM-3|ICAM-5|Icam3|Tlcn|TLN
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EPFWADLQPRVALVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELVPLPSWQPVGENFTLSCRVPGAGPRASLTLTLLRGGQELIRRSFVGEPPRARGAMLTARVLARREDHRVNFSCLAELDLRPHGLGLFANSSAPRQLRTFAMP
Uniprot:: Q60625
Synonyms:: CD50;Ica;ICAM-3;ICAM-5;Icam3;intercellular adhesion molecule 3;intercellular adhesion molecule 5;intercellular adhesion molecule 5, telencephalin;T;telencephalin;Tl;TLCN;TLN
Extra Details:: Predicted to enable integrin binding activity. Acts upstream of or within phagocytosis. Located in plasma membrane. Is expressed in brain. Orthologous to human ICAM5 (intercellular adhesion molecule 5).