A26777
PXDN Rabbit monoclonal antibody
Size
POA
- SKU:
- A26777
- Additional Names:
- ASGD7|COPOA|D2S448|D2S448E|hsPxd01|MG50|PRG2|PXN|VPO
- Application:
- ELISA, WB
- Molecular Weight:
- 165kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQ
- Uniprot:
- Q92626
- Synonyms:
- ASGD7;COPOA;D2S448;D2S448E;melanoma-associated antigen MG50;MG50;p53-responsive gene 2 protein;peroxidasin homolog;PRG2;PXN;vascular peroxidase 1;VPO
- Extra Details:
- This gene encodes a heme-containing peroxidase that is secreted into the extracellular matrix. It is involved in extracellular matrix formation, and may function in the physiological and pathological fibrogenic response in fibrotic kidney. Mutations in this gene cause corneal opacification and other ocular anomalies, and also microphthalmia and anterior segment dysgenesis.
- Shipping Conditions:
- Blue Ice