ABflo[R] 488 Rabbit anti-Mouse CD182/CXCR2 monoclonal antibody

Size

POA

SKU:: A26757
Additional Names:: CD128|CDw128|Cmkar2|Gpcr16|IL-8rb|IL-8Rh|IL8RA|Il8rb|mIL-8RH
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLE
Uniprot:: P35343
Synonyms:: C-X-C chemokine receptor type 2;CD128;CD182;CDw128;CDw128b;chemokine (C-X-C) receptor 2;chemokine (CXC) receptor 2;Cmka;CMKAR2;CXC-R2;CXCR-2;CXCR2 gene for IL8 receptor type B;Gpcr;Gpcr16;GRO/MGSA receptor;high affinity interleukin-8 receptor B;I;Il;IL-;IL-8 receptor alpha chain;IL-8 receptor type 2;IL-8R B;IL-8rb;IL-8Rh;IL8R2;IL8RA;IL8RB;interleukin 8 receptor type 2;interleukin 8 receptor, beta;interleukin-8 receptor type B;mIL-8RH;WHIMS2
Extra Details:: Enables chemokine receptor activity. Acts upstream of or within negative regulation of apoptotic process. Predicted to be located in several cellular components, including cell surface; mast cell granule; and mitotic spindle. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; embryo mesenchyme; epithelium; and heart. Human ortholog(s) of this gene implicated in IgA glomerulonephritis; acute pyelonephritis; end stage renal disease; and urinary bladder cancer. Orthologous to human CXCR2 (C-X-C motif chemokine receptor 2).

Shipping Conditions:: Blue Ice