CD11b Rabbit PolymAb[R]

Size

POA

SKU:: A26754PM
Additional Names:: CD11B|CR3A|MAC-1|MAC1A|MO1A|SLEB6
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 170 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPP
Uniprot:: P05555, P11215
Synonyms:: antigen CD11b (p170);CD11 antigen-like family member B;CD11B;CD11B (p170);CD11b/CD18;cell surface glycoprotein MAC-1 alpha subunit;cell surface glycoprotein MAC-1 subunit alpha;complement component 3 receptor 3 subunit;complement receptor type 3;CR;CR-3 alpha chain;CR3;CR3A;F730045J24Rik;integrin alpha-M;integrin, alpha M (complement component 3 receptor 3 subunit);leukocyte adhesion receptor MO1;Ly-4;Ly-40;Mac-;MAC-1;Mac-1 alpha;Mac-1a;MAC1;MAC1A;macrophage antigen alpha;macrophage antigen alpha polypeptide;macrophage-1 antigen alpha subunit;MO1A;Neutrophil adherence receptor;neutrophil adherence receptor alpha-M subunit;SLEB6
Extra Details:: This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice