APC/Cyanine7 Rabbit anti-Mouse CD8a monoclonal antibody

Size

POA

SKU:: A26743
Additional Names:: Ly-2|Ly-35|Ly-B|Lyt-2
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
Uniprot:: P01731
Synonyms:: activation B7-1 antigen;B-lymphocyte activation antigen B7;B7;B7-1;B7.1;BB1;BB154331;CD28LG;CD28LG1;CD80 antigen (CD28 antigen ligand 1, B7-1 antigen);costimulatory factor CD80;costimulatory molecule variant IgV-CD80;CTLA-4 counter-receptor B7.1;LAB7;Ly-;Ly-2;Ly-3;Ly-35;Ly-B;Lyt-;Lyt-2;Lyt-2.1 lymphocyte differentiation antigen (AA at 100);T-cell surface glycoprotein CD8 alpha chain;T-cell surface glycoprotein Lyt-2;T-lymphocyte activation antigen CD80
Extra Details:: Enables identical protein binding activity. Acts upstream of or within several processes, including cytotoxic T cell differentiation; defense response to virus; and positive regulation of calcium-mediated signaling. Located in external side of plasma membrane. Is expressed in several structures, including endocrine gland; exocrine gland; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human CD8A (CD8a molecule).

Shipping Conditions:: Blue Ice