PE Rabbit anti-Human CD262/DR5/TRAIL-R2 monoclonal antibody

Size

POA

SKU:: A26741
Additional Names:: CD262|DR5|KILLER|KILLER/DR5|TRAIL-R2|TRAILR2|TRICK2|TRICK2A|TRICK2B|TRICKB|ZTNFR9
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Uniprot:: O14763
Synonyms:: apoptosis inducing protein TRICK2A/2B;apoptosis inducing receptor TRAIL-R2;CD262;cytotoxic TRAIL receptor-2;death domain containing receptor for TRAIL/Apo-2L;death receptor 5;DR5;Fas-like protein;KILLER;KILLER/DR5;p53-regulated DNA damage-inducible cell death receptor(killer);TNF-related apoptosis-inducing ligand receptor 2;TRAIL-R2;TRAILR2;TRICK2;TRICK2A;TRICK2B;TRICKB;tumor necrosis factor receptor superfamily member 10B;tumor necrosis factor receptor superfamily, member 10b;tumor necrosis factor receptor-like protein ZTNFR9;ZTNFR9
Extra Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.

Shipping Conditions:: Blue Ice