ABflo[R] 488 Rabbit anti-Human CD52 monoclonal antibody

Size

POA

SKU:: A26721
Additional Names:: CDW52|EDDM5|HE5
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Uniprot:: P31358
Synonyms:: cambridge pathology 1 antigen;CAMPATH-1 antigen;CD52 antigen (CAMPATH-1 antigen);CDW52;CDW52 antigen (CAMPATH-1 antigen);EDDM5;epididymal secretory protein E5;epididymis secretory sperm binding protein Li 171mP;HE5;HEL-S-171mP;human epididymis-specific protein 5
Extra Details:: Involved in positive regulation of cytosolic calcium ion concentration. Predicted to be located in extracellular region and plasma membrane. Predicted to be intrinsic component of plasma membrane. Predicted to be active in sperm midpiece.