A2671
Calpain 2 Rabbit polyclonal antibody

Size
POA
- SKU:
- A2671
- Additional Names:
- Calpain 2|CANP2|CANPL2|CANPml|mCANP
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
- Uniprot:
- P17655
- Synonyms:
- calcium-activated neutral proteinase 2;calpain 2, (m/II) large subunit;calpain 2, large [catalytic] subunit;calpain 2, large subunit;Calpain large polypeptide L2;calpain M-type;calpain-2 catalytic subunit;Calpain-2 large subunit;calpain, large polypeptide L2;CANP 2;CANP2;CANPL2;CANPml;M-calpain;mCANP;millimolar-calpain
- Extra Details:
- The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites in the 5' UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice








