A26708
[KD Validated] SREBF1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A26708
- Additional Names:
- ADD1|bHLHd1|SREBP1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 68 kDa/125 kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPS
- Uniprot:
- Q9WTN3
- Synonyms:
- ADD-;ADD1;adipocyte determination- and differentiation-dependent factor 1;bHLHd;bHLHd1;class D basic helix-loop-helix protein 1;HMD;IFAP2;SRE;SREB;SREBP;SREBP1;sterol regulatory element-binding protein 1;Sterol regulatory element-binding transcription factor 1
- Extra Details:
- This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. Alternatively spliced transcript variants have been characterized for this gene.
- Shipping Conditions:
- Blue Ice
![[KD Validated] SREBF1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26708/A26708_1.jpg)
![[KD Validated] SREBF1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26708/A26708_2.jpg)
![[KD Validated] SREBF1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26708/A26708_3.jpg)
![[KD Validated] SREBF1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26708/A26708_ARC70394-01_WB_01.jpg)
![[KD Validated] SREBF1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26708/A26708_ARC70394-01_WB_02.jpg)
![[KD Validated] SREBF1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26708/A26708_ARC70394-02_WB_01.jpg)
![[KD Validated] SREBF1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26708/A26708_ARC70394-01_IHC_01.jpg)