APC Rabbit anti-Human CD158a/KIR2DL1 monoclonal antibody

Size

POA

SKU:: A26681
Additional Names:: CD158A|KIR-K64|KIR221|KIR2DL3|NKAT|NKAT-1|NKAT1|p58.1
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Uniprot:: P43626
Synonyms:: CD158 antigen-like family member A;CD158A;killer cell immunoglobulin-like receptor 2DL1;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1;killer inhibitory receptor 2-2-1;KIR-K64;KIR221;KIR2DL protein;KIR2DL1/3DL2;KIR2DL3;MHC class I NK cell receptor;natural killer-associated transcript 1;NKAT;NKAT-1;NKAT1;p58 killer cell inhibitory receptor KIR-K64;p58 natural killer cell receptor clones CL-42/47.11;p58 NK cell inhibitory receptor NKR-K6;p58 NK receptor CL-42/47.11;p58.1;p58.1 MHC class-I-specific NK receptor
Extra Details:: Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.

Shipping Conditions:: Blue Ice