Complement C3 Rabbit PolymAb[R]

Size

POA

SKU:: A26625PM
Additional Names:: AHUS5|ARMD9|ASP|C3a|C3b|CPAMD1|HEL-S-62p
Application:: ELISA, WB
Molecular Weight:: 115kDa/187kDa
Species Reactivity:: Human, Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN
Uniprot:: P01024, P01027
Synonyms:: acylation stimulating protein;acylation-stimulating protein cleavage product;AHUS5;AI255234;ARMD9;ASP;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1;C3a;C3a anaphylatoxin;C3b;complement C3;complement component 3;complement component 3d;complement component C3a;complement component C3b;complement factor 3;CPAMD1;epididymis secretory sperm binding protein Li 62p;HEL-S-62p;HSE-MSF;Plp;prepro-C3
Extra Details:: Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form the mature protein, which is then further processed to generate numerous peptide products. The C3a peptide, also known as the C3a anaphylatoxin, modulates inflammation and possesses antimicrobial activity. Mutations in this gene are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients.

Shipping Conditions:: Blue Ice