CD24 Rabbit PolymAb[R]

Size

POA

SKU:: A26624PM
Additional Names:: CD24A
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 30-70kDa
Species Reactivity:: Human, Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Uniprot:: P24807, P25063
Synonyms:: Cd24;CD24 antigen (small cell lung carcinoma cluster 4 antigen);CD24A;cluster of differentiation 24;H;heat stable antigen;HSA;Ly-5;Ly-52;lymphocyte antigen 52;M1/69-J11D heat stable antigen;nect;nectadrin;R13-Ag;signal transducer CD24;Small cell lung carcinoma cluster 4 antigen;X62 heat stable antigen
Extra Details:: This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants.