PE Rabbit anti-Human CD85i/j monoclonal antibody

Size

POA

SKU:: A26583
Additional Names:: CD85I|LIR-6|LIR6
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN
Uniprot:: O75019, Q8NHL6
Synonyms:: CD85 antigen-like family member I;CD85 antigen-like family member J;CD85I;CD85J;Ig-like transcript 2;ILT-2;ILT2;immunoglobulin heavy chain variable region;Immunoglobulin-like transcript 2;leucocyte Ig-like receptor A1;leucocyte Ig-like receptor B1;leukocyte immunoglobulin-like receptor 6;leukocyte immunoglobulin-like receptor subfamily A member 1;leukocyte immunoglobulin-like receptor subfamily B member 1;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1;LIR-1;LIR-6;LIR1;LIR6;MIR-7;MIR7;monocyte/macrophage immunoglobulin-like receptor 7;myeloid inhibitory receptor 7;PIR-B;PIRB
Extra Details:: This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompatibility complex class I ligands, and contributes to the regulation of immune responses. Alternative splicing results in multiple transcript variants encoding different isoforms.

Shipping Conditions:: Blue Ice