PE Rabbit anti-Human CD49c/ITGA3 monoclonal antibody

Size

POA

SKU:: A26580
Additional Names:: CD49C|FRP-2|GAP-B3|GAPB3|ILNEB|JEB7|MSK18|VCA-2|VL3A|VLA3a
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: INIVHKTLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNK
Uniprot:: P26006
Synonyms:: alpha 3 subunit of VLA-3 receptor;antigen CD49C;antigen identified by monoclonal antibody J143;CD49 antigen-like family member C;CD49C;FRP-2;galactoprotein B3;GAP-B3;GAPB3;ILNEB;integrin alpha 3;integrin alpha-3;integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor);MSK18;testicular tissue protein Li 96;testicular tissue protein Li 98;VCA-2;very late activation protein 3 receptor, alpha-3 subunit;VL3A;VLA-3 subunit alpha;VLA3a
Extra Details:: The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis.

Shipping Conditions:: Blue Ice