PE Rabbit anti-Mouse PD-L2/CD273/B7-DC monoclonal antibody

Size

POA

SKU:: A26554
Additional Names:: B7-DC|Btdc|F730015O22Rik|PD-L2
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASY
Uniprot:: Q9WUL5
Synonyms:: B7 dendritic cell molecule;B7-DC;B7DC;bA574F11.2;Btdc;butyrophilin B7-DC;butyrophilin-like protein;CD273;F730015O22Rik;PD-;PD-1 ligand 2;PD-1-ligand 2;PD-L2;PDCD1 ligand 2;PDCD1L2;PDL2;programmed cell death 1 ligand 2;programmed death ligand 2
Extra Details:: Acts upstream of or within negative regulation of T cell proliferation and positive regulation of T cell proliferation. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system epithelium; forebrain; nose; retina; and skin. Orthologous to human PDCD1LG2 (programmed cell death 1 ligand 2).