ABflo[R] 450 Rabbit anti-Mouse CD83 monoclonal antibody

Size

POA

SKU:: A26549
Additional Names:: mCD83
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR
Uniprot:: O88324
Synonyms:: B-cell activation protein;BL11;CD83 antigen;CD83 antigen (activated B lymphocytes, immunoglobulin superfamily);cell surface protein HB15;cell-surface glycoprotein;HB15;hCD83;mCD83
Extra Details:: Acts upstream of or within positive regulation of CD4-positive, alpha-beta T cell differentiation; regulation of cytokine production; and response to organic cyclic compound. Located in external side of plasma membrane. Is expressed in alimentary system; genitourinary system; hemolymphoid system gland; and nervous system. Orthologous to human CD83 (CD83 molecule).