PE Rabbit anti-Mouse CD150/SLAM monoclonal antibody

Size

POA

SKU:: A26519
Additional Names:: 4933415F16|CD150|CDw150|ESTM51|IPO-3|Slam
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP
Uniprot:: Q9QUM4
Synonyms:: 4933415F16;AA177906;CD150;CDw150;ESTM5;ESTM51;IP;IPO-3;S;signaling lymphocyte activation molecule;signaling lymphocytic activation molecule;SLAM;SLAM family member 1
Extra Details:: Enables identical protein binding activity and signaling receptor activity. Involved in natural killer cell activation; positive regulation of activated T cell proliferation; and regulation of cytokine production. Acts upstream of or within several processes, including leukocyte chemotaxis involved in inflammatory response; positive regulation of leukocyte chemotaxis; and regulation of vesicle fusion. Located in external side of plasma membrane and phagocytic vesicle. Is expressed in liver lobe. Orthologous to human SLAMF1 (signaling lymphocytic activation molecule family member 1).