APC Rabbit anti-Mouse CD25 monoclonal antibody

Size

POA

SKU:: A26509
Additional Names:: CD25|Il2r|Ly-43
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
Uniprot:: P01590
Synonyms:: CD25;I;IDDM10;IL-2 receptor subunit alpha;IL-2-RA;IL-2R alpha chain;IL-2R subunit alpha;IL2-RA;IL2R;IMD41;interleukin 2 receptor, alpha;interleukin-2 receptor subunit alpha;Ly-4;Ly-43;p55;p55 chain;TAC antigen;TCGFR
Extra Details:: Enables interleukin-2 binding activity and interleukin-2 receptor activity. Acts upstream of or within several processes, including Notch signaling pathway; activation-induced cell death of T cells; and regulation of T cell proliferation. Located in external side of plasma membrane. Is expressed in bone marrow. Used to study Sjogren's syndrome and inflammatory bowel disease. Human ortholog(s) of this gene implicated in immunodeficiency 41; lymphopenia; multiple sclerosis; type 1 diabetes mellitus; and type 1 diabetes mellitus 10. Orthologous to human IL2RA (interleukin 2 receptor subunit alpha).

Shipping Conditions:: Blue Ice