PE Rabbit anti-Human/Monkey CD127/IL-7RA Alpha monoclonal antibody

Size

POA

SKU:: A26503
Additional Names:: CD127|CDW127|IL-7R-alpha|IL-7Ralpha|IL7RA|IL7Ralpha|ILRA|IMD104|lnc-IL7R|sIL-7R
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSG
Uniprot:: P16871
Synonyms:: CD127;CD127 antigen;CDW127;IL-7 receptor subunit alpha;IL-7R subunit alpha;IL-7R-alpha;IL7RA;ILRA;interleukin 7 receptor alpha chain;interleukin-7 receptor subunit alpha
Extra Details:: The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found.