PE Rabbit anti-Mouse CD94 monoclonal antibody

Size

POA

SKU:: A26470
Additional Names:: CD94
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
Uniprot:: O54707
Synonyms:: CD94;CD94 antigen;Killer cell lectin-like receptor subfamily D member 1;killer cell lectin-like receptor subfamily D, member 1;KP43;natural killer cells antigen CD94;NK cell receptor
Extra Details:: CD94 is a 43/39 kD C-type lectin, also known as Kp43. It is present on all NK cells, NKT cells, and a subset of CD8-positive T lymphocytes in most mouse strains. CD94 is a type-II transmembrane protein with an extracellular lectin-like domain and a short cytoplasmic tail. CD94 is expressed as a disulphide-linked heterodimer with a NKG2 subunit believed to mediate signal transduction. When associated with NKG2A, the complex triggers inhibition; when associated with NKG2C, the complex triggers stimulation. The receptor complex of CD94 and NKG2 receptors bind to the ligand, Qa-1, and are thought to play a role in maintaining self-tolerance in developing NK cells.