ABflo[R] 610 Rabbit anti-Human/Monkey CD20 monoclonal antibody

Size

POA

SKU:: A26466
Additional Names:: B1|Bp35|CD20|CVID5|FMC7|LEU-16|S7
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Uniprot:: P11836
Synonyms:: B-lymphocyte antigen CD20;B-lymphocyte cell-surface antigen B1;B-lymphocyte surface antigen B1;B1;Bp35;CD20;CD20 antigen;CD20 receptor;CVID5;FMC7;LEU-16;leukocyte surface antigen Leu-16;Membrane-spanning 4-domains subfamily A member 1;membrane-spanning 4-domains, subfamily A, member 1;S7
Extra Details:: This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.

Shipping Conditions:: Blue Ice