ABflo[R] 488 Rabbit anti-Human CD300 a/c monoclonal antibody

Size

POA

SKU:: A26406
Additional Names:: CLM-8|CMRF-35-H9|CMRF-35H|CMRF35-H|CMRF35-H9|CMRF35H|CMRF35H9|IGSF12|IRC1|IRC1/IRC2|IRC2|IRp60
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ
Uniprot:: Q08708, Q9UGN4
Synonyms:: CD300 antigen-like family member A;CD300 antigen-like family member C;CD300a antigen;CD300c antigen;CLM-6;CLM-8;CMRF-35;CMRF-35-H9;CMRF-35A;CMRF-35H;CMRF35;CMRF35 antigen;CMRF35 leukocyte immunoglobulin-like receptor;CMRF35-A1;CMRF35-H;CMRF35-H9;CMRF35-like molecule 6;CMRF35-like molecule 8;CMRF35A;CMRF35A leukocyte immunoglobulin-like receptor;CMRF35A1;CMRF35H;CMRF35H leukocyte immunoglobulin-like receptor;CMRF35H9;IGSF12;IGSF16;immunoglobulin superfamily member 12;immunoglobulin superfamily member 16;inhibitory receptor protein 60;IRC1;IRC1/IRC2;IRC2;IRp60;leukocyte membrane antigen;LIR;NK inhibitory receptor
Extra Details:: This gene encodes a member of the CD300 glycoprotein family of cell surface proteins found on leukocytes involved in immune response signaling pathways. This gene is located on chromosome 17 in a cluster with all but one of the other family members. Multiple transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice