[KD Validated] EFTUD2 Rabbit monoclonal antibody

Size

POA

SKU:: A26306
Additional Names:: MFDGA|MFDM|SNRNP116|Snrp116|Snu114|U5-116KD
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 120kDa//109-120kd
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDT
Uniprot:: Q15029
Synonyms:: 116 kDa U5 small nuclear ribonucleoprotein component;elongation factor Tu GTP-binding domain-containing protein 2;hSNU114;MFDGA;MFDM;SNRNP116;Snrp116;Snu114;SNU114 homolog;U5 snRNP-specific protein, 116 kDa;U5-116KD
Extra Details:: This gene encodes a GTPase which is a component of the spliceosome complex which processes precursor mRNAs to produce mature mRNAs. Mutations in this gene are associated with mandibulofacial dysostosis with microcephaly. Multiple transcript variants encoding different isoforms have been found for this gene.