PE Rabbit anti-Mouse IL-9 monoclonal antibody

Size

POA

SKU:: A26265
Additional Names:: Il-9|P40
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCN
Uniprot:: P15247
Synonyms:: cytokine P40;homolog of mouse T cell and mast cell growth factor 40;HP40;Il;IL-9;interleukin-9;P4;P40;p40 cytokine;p40 T-cell and mast cell growth factor;T-cell growth factor p40
Extra Details:: Enables cytokine activity. Involved in positive regulation of interleukin-5 production. Acts upstream of or within several processes, including B cell activation; regulation of cellular protein metabolic process; and regulation of receptor signaling pathway via JAK-STAT. Located in extracellular space. Is expressed in gut; liver; thymus; and thymus primordium. Human ortholog(s) of this gene implicated in asthma and respiratory syncytial virus infectious disease. Orthologous to human IL9 (interleukin 9).