A26244
[KD Validated] VDAC3 Rabbit monoclonal antibody

Size
POA
- SKU:
- A26244
- Additional Names:
- HD-VDAC3|VDAC-3
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 31kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLD
- Uniprot:
- Q9Y277
- Synonyms:
- HD-VDAC3;outer mitochondrial membrane protein porin 3;VDAC-3;voltage-dependent anion-selective channel protein 3
- Extra Details:
- This gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_1.jpg)
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_2.jpg)
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_3.jpg)
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_4.jpg)
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_5.jpg)
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_ARC69554-01_WB_01.jpg)
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_ARC69554-01_WB_02.jpg)
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_ARC69554-01_WB_03.jpg)
![[KD Validated] VDAC3 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A26244/A26244_ARC69554-01_IHC_01.jpg)